SCOP 1.59: Domain d1gawb1: 1gaw B:10-156

Lineage for d1gawb1 (1gaw B:10-156)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)

7. Species Maize (Zea mays), leaf isoform [TaxId:4577] [50419] (2 PDB entries)

8. Domain d1gawb1: 1gaw B:10-156 [25644]
   Other proteins in same PDB: d1gawa2, d1gawb2

Details for d1gawb1

PDB Entry: 1gaw, 2.2 Å

PDB Description: crystal structure analysis of the ferredoxin-nadp+ reductase from maize leaf

SCOP Domain Sequences for d1gawb1:

Sequence; same for both SEQRES and ATOM records:

>d1gawb1 b.43.4.2 (B:10-156) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), leaf isoform}
apatakakkeskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkip
yregqsigviadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivk
gvcsnflcdlqpgdnvqitgpvgkeml

Timeline for d1gawb1:

• d1gawb1 first appeared (with stable ids) in SCOP 1.55
  
• d1gawb1 appears in SCOP 1.57
  
• d1gawb1 appears in SCOP 1.61
  
• d1gawb1 appears in the current release, SCOPe 2.08