Lineage for d2mela1 (2mel A:3-33)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2257552Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2257668Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 2257795Protein automated matches [197331] (4 species)
    not a true protein
  7. 2257804Species Mesobuthus tamulus [TaxId:34647] [255376] (7 PDB entries)
  8. 2257807Domain d2mela1: 2mel A:3-33 [256424]
    Other proteins in same PDB: d2mela2
    automated match to d1scya_
    mutant

Details for d2mela1

PDB Entry: 2mel (more details)

PDB Description: nmr solution structure of the gs-tamapin mutation r7a
PDB Compounds: (A:) Potassium channel toxin alpha-KTx 5.4

SCOPe Domain Sequences for d2mela1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mela1 g.3.7.2 (A:3-33) automated matches {Mesobuthus tamulus [TaxId: 34647]}
afcnlracelscrslgllgkcigeeckcvpy

SCOPe Domain Coordinates for d2mela1:

Click to download the PDB-style file with coordinates for d2mela1.
(The format of our PDB-style files is described here.)

Timeline for d2mela1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mela2