Lineage for d1fb3a1 (1fb3 A:67-207)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167557Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 167645Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) (S)
  5. 167665Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (8 proteins)
  6. 167681Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)
  7. 167717Species Paprika (Capsicum annuum) [TaxId:4072] [50418] (1 PDB entry)
  8. 167718Domain d1fb3a1: 1fb3 A:67-207 [25641]
    Other proteins in same PDB: d1fb3a2, d1fb3b2

Details for d1fb3a1

PDB Entry: 1fb3 (more details), 2.5 Å

PDB Description: crystal structure analysis of the ferredoxin-nadp+ reductase from paprika

SCOP Domain Sequences for d1fb3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fb3a1 b.43.4.2 (A:67-207) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Paprika (Capsicum annuum)}
iskkqdegvvvnkfrpkepyigrcllntkitgddapgetwhmvfstegeipyregqsigv
iadgvdangkphklrlysiassalgdfgdsktvslcvkrlvytndkgeevkgvcsnflcd
lkpgadvkitgpvgkemlmpk

SCOP Domain Coordinates for d1fb3a1:

Click to download the PDB-style file with coordinates for d1fb3a1.
(The format of our PDB-style files is described here.)

Timeline for d1fb3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fb3a2