SCOP 1.75: Domain d1qgab1: 1qga B:514-653

Lineage for d1qgab1 (1qga B:514-653)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [50417] (4 PDB entries)

8. Domain d1qgab1: 1qga B:514-653 [25638]
   Other proteins in same PDB: d1qgaa2, d1qgab2
   complexed with fad, nap, so4; mutant

Details for d1qgab1

PDB Entry: 1qga, 2 Å

PDB Description: pea fnr y308w mutant in complex with nadp+

PDB Compounds: (B:) protein (ferredoxin:nadp+ reductase)

SCOP Domain Sequences for d1qgab1:

Sequence; same for both SEQRES and ATOM records:

>d1qgab1 b.43.4.2 (B:514-653) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Garden pea (Pisum sativum) [TaxId: 3888]}
skkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigiv
pdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcdl
kpgsevkitgpvgkemlmpk

Timeline for d1qgab1:

• d1qgab1 first appeared (with stable ids) in SCOP 1.55
  
• d1qgab1 appears in SCOP 1.73
  
• d1qgab1 appears in SCOPe 2.01
  
• d1qgab1 appears in the current release, SCOPe 2.08