Lineage for d1qgab1 (1qga B:514-653)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793526Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2793554Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)
  7. 2793592Species Pea (Pisum sativum) [TaxId:3888] [50417] (4 PDB entries)
  8. 2793598Domain d1qgab1: 1qga B:514-653 [25638]
    Other proteins in same PDB: d1qgaa2, d1qgab2
    complexed with fad, nap, so4; mutant

Details for d1qgab1

PDB Entry: 1qga (more details), 2 Å

PDB Description: pea fnr y308w mutant in complex with nadp+
PDB Compounds: (B:) protein (ferredoxin:nadp+ reductase)

SCOPe Domain Sequences for d1qgab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgab1 b.43.4.2 (B:514-653) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Pea (Pisum sativum) [TaxId: 3888]}
skkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigiv
pdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcdl
kpgsevkitgpvgkemlmpk

SCOPe Domain Coordinates for d1qgab1:

Click to download the PDB-style file with coordinates for d1qgab1.
(The format of our PDB-style files is described here.)

Timeline for d1qgab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qgab2