Class b: All beta proteins [48724] (149 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (9 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species) |
Species Garden pea (Pisum sativum) [TaxId:3888] [50417] (4 PDB entries) |
Domain d1qgab1: 1qga B:514-653 [25638] Other proteins in same PDB: d1qgaa2, d1qgab2 complexed with fad, nap, so4; mutant |
PDB Entry: 1qga (more details), 2 Å
SCOP Domain Sequences for d1qgab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qgab1 b.43.4.2 (B:514-653) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Garden pea (Pisum sativum)} skkqdenivvnkfkpkepyvgrcllntkitgddapgetwhmvfstegevpyregqsigiv pdgidkngkphklrlysiassaigdfgdsktvslcvkrlvytndagevvkgvcsnflcdl kpgsevkitgpvgkemlmpk
Timeline for d1qgab1: