Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) |
Family b.42.5.2: Histidine-rich actin-binding protein (hisactophilin) [50409] (1 protein) |
Protein Histidine-rich actin-binding protein (hisactophilin) [50410] (1 species) |
Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50411] (2 PDB entries) |
Domain d1hcda_: 1hcd A: [25624] |
PDB Entry: 1hcd (more details)
SCOPe Domain Sequences for d1hcda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Slime mold (Dictyostelium discoideum) [TaxId: 44689]} mgnrafkshhghflsaegeavkthhghhdhhthfhvenhggkvalkthcgkylsigdhkq vylshhlhgdhslfhlehhggkvsikghhhhyisadhhghvstkehhdhdttfeeiii
Timeline for d1hcda_: