Lineage for d1hcda_ (1hcd A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791605Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2792682Superfamily b.42.5: Actin-crosslinking proteins [50405] (3 families) (S)
  5. 2792794Family b.42.5.2: Histidine-rich actin-binding protein (hisactophilin) [50409] (1 protein)
  6. 2792795Protein Histidine-rich actin-binding protein (hisactophilin) [50410] (1 species)
  7. 2792796Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [50411] (2 PDB entries)
  8. 2792797Domain d1hcda_: 1hcd A: [25624]

Details for d1hcda_

PDB Entry: 1hcd (more details)

PDB Description: structure of hisactophilin is similar to interleukin-1 beta and fibroblast growth factor
PDB Compounds: (A:) hisactophilin

SCOPe Domain Sequences for d1hcda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
mgnrafkshhghflsaegeavkthhghhdhhthfhvenhggkvalkthcgkylsigdhkq
vylshhlhgdhslfhlehhggkvsikghhhhyisadhhghvstkehhdhdttfeeiii

SCOPe Domain Coordinates for d1hcda_:

Click to download the PDB-style file with coordinates for d1hcda_.
(The format of our PDB-style files is described here.)

Timeline for d1hcda_: