PDB entry 1hcd

View 1hcd on RCSB PDB site
Description: structure of hisactophilin is similar to interleukin-1 beta and fibroblast growth factor
Class: actin binding
Keywords: actin binding
Deposited on 1994-05-03, released 1994-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hisactophilin
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1hcda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hcdA (A:)
    mgnrafkshhghflsaegeavkthhghhdhhthfhvenhggkvalkthcgkylsigdhkq
    vylshhlhgdhslfhlehhggkvsikghhhhyisadhhghvstkehhdhdttfeeiii