Lineage for d1d0ha2 (1d0h A:1111-1315)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167295Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 167492Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 167521Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins)
  6. 167529Protein Tetanus neurotoxin [50400] (1 species)
  7. 167530Species Clostridium tetani [50401] (8 PDB entries)
  8. 167534Domain d1d0ha2: 1d0h A:1111-1315 [25610]
    Other proteins in same PDB: d1d0ha1

Details for d1d0ha2

PDB Entry: 1d0h (more details), 2.1 Å

PDB Description: the hc fragment of tetanus toxin complexed with n-acetyl-galactosamine

SCOP Domain Sequences for d1d0ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d0ha2 b.42.4.2 (A:1111-1315) Tetanus neurotoxin {Clostridium tetani}
itflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklniyyrrly
nglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldrilrvgyn
apgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdiliasnwy
fnhlkdkilgcdwyfvptdegwtnd

SCOP Domain Coordinates for d1d0ha2:

Click to download the PDB-style file with coordinates for d1d0ha2.
(The format of our PDB-style files is described here.)

Timeline for d1d0ha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d0ha1