Lineage for d1ba7b_ (1ba7 B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375317Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 375571Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 375572Family b.42.4.1: Kunitz (STI) inhibitors [50387] (5 proteins)
  6. 375588Protein Soybean trypsin inhibitor [50394] (1 species)
  7. 375589Species Soybean (Glycine max) [TaxId:3847] [50395] (4 PDB entries)
  8. 375593Domain d1ba7b_: 1ba7 B: [25602]

Details for d1ba7b_

PDB Entry: 1ba7 (more details), 2.5 Å

PDB Description: soybean trypsin inhibitor

SCOP Domain Sequences for d1ba7b_:

Sequence, based on SEQRES records: (download)

>d1ba7b_ b.42.4.1 (B:) Soybean trypsin inhibitor {Soybean (Glycine max)}
dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
ervsddefnnyklvfcpqqaeddkcgdigisidhddgtrrlvvsknkplvvqfqkl

Sequence, based on observed residues (ATOM records): (download)

>d1ba7b_ b.42.4.1 (B:) Soybean trypsin inhibitor {Soybean (Glycine max)}
dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
ervsfnnyklvfcpqdkcgdigisidhddgtrrlvvsknkplvvqfqkl

SCOP Domain Coordinates for d1ba7b_:

Click to download the PDB-style file with coordinates for d1ba7b_.
(The format of our PDB-style files is described here.)

Timeline for d1ba7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ba7a_