Lineage for d1ba7b_ (1ba7 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053846Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2053847Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 protein domains)
    automatically mapped to Pfam PF00197
  6. 2053871Protein Soybean trypsin inhibitor [50394] (1 species)
  7. 2053872Species Soybean (Glycine max) [TaxId:3847] [50395] (4 PDB entries)
  8. 2053876Domain d1ba7b_: 1ba7 B: [25602]

Details for d1ba7b_

PDB Entry: 1ba7 (more details), 2.5 Å

PDB Description: soybean trypsin inhibitor
PDB Compounds: (B:) trypsin inhibitor (kunitz)

SCOPe Domain Sequences for d1ba7b_:

Sequence, based on SEQRES records: (download)

>d1ba7b_ b.42.4.1 (B:) Soybean trypsin inhibitor {Soybean (Glycine max) [TaxId: 3847]}
dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
ervsddefnnyklvfcpqqaeddkcgdigisidhddgtrrlvvsknkplvvqfqkl

Sequence, based on observed residues (ATOM records): (download)

>d1ba7b_ b.42.4.1 (B:) Soybean trypsin inhibitor {Soybean (Glycine max) [TaxId: 3847]}
dfvldnegnplenggtyyilsditafggiraaptgnercpltvvqsrneldkgigtiiss
pyrirfiaeghplslkfdsfavimlcvgiptewsvvedlpegpavkigenkdamdgwfrl
ervsfnnyklvfcpqdkcgdigisidhddgtrrlvvsknkplvvqfqkl

SCOPe Domain Coordinates for d1ba7b_:

Click to download the PDB-style file with coordinates for d1ba7b_.
(The format of our PDB-style files is described here.)

Timeline for d1ba7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ba7a_