SCOPe 2.05: Domain d1dqoa_: 1dqo A:

Lineage for d1dqoa_ (1dqo A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.2: Cysteine rich domain [50379] (1 protein)

6. Protein Mannose receptor [50380] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50381] (4 PDB entries)

8. Domain d1dqoa_: 1dqo A: [25582]
   complexed with asg

Details for d1dqoa_

PDB Entry: 1dqo, 2.2 Å

PDB Description: crystal structure of the cysteine rich domain of mannose receptor complexed with acetylgalactosamine-4-sulfate

PDB Compounds: (A:) mannose receptor

SCOPe Domain Sequences for d1dqoa_:

Sequence; same for both SEQRES and ATOM records:

>d1dqoa_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]}
darqfliynedhkrcvdalsaisvqtatcnpeaesqkfrwvsdsqimsvafklclgvpsk
tdwasvtlyacdskseyqkweckndtlfgikgtelyfnygnrqekniklykgsglwsrwk
vygttddlcsrgye

Timeline for d1dqoa_:

• d1dqoa_ first appeared (with stable ids) in SCOP 1.55
  
• d1dqoa_ appears in SCOPe 2.04
  
• d1dqoa_ appears in SCOPe 2.06
  
• d1dqoa_ appears in the current release, SCOPe 2.08