Lineage for d1dqoa_ (1dqo A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385272Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2385492Family b.42.2.2: Cysteine rich domain [50379] (1 protein)
  6. 2385493Protein Mannose receptor [50380] (1 species)
  7. 2385494Species Mouse (Mus musculus) [TaxId:10090] [50381] (4 PDB entries)
  8. 2385498Domain d1dqoa_: 1dqo A: [25582]
    complexed with asg

Details for d1dqoa_

PDB Entry: 1dqo (more details), 2.2 Å

PDB Description: Crystal structure of the cysteine rich domain of mannose receptor complexed with Acetylgalactosamine-4-sulfate
PDB Compounds: (A:) mannose receptor

SCOPe Domain Sequences for d1dqoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dqoa_ b.42.2.2 (A:) Mannose receptor {Mouse (Mus musculus) [TaxId: 10090]}
darqfliynedhkrcvdalsaisvqtatcnpeaesqkfrwvsdsqimsvafklclgvpsk
tdwasvtlyacdskseyqkweckndtlfgikgtelyfnygnrqekniklykgsglwsrwk
vygttddlcsrgye

SCOPe Domain Coordinates for d1dqoa_:

Click to download the PDB-style file with coordinates for d1dqoa_.
(The format of our PDB-style files is described here.)

Timeline for d1dqoa_: