Lineage for d1hwmb1 (1hwm B:3-135)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543418Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1543419Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 1543501Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 1543542Species Sambucus ebulus, ebulin [TaxId:28503] [50376] (4 PDB entries)
  8. 1543543Domain d1hwmb1: 1hwm B:3-135 [25569]
    Other proteins in same PDB: d1hwma_
    complexed with gal

Details for d1hwmb1

PDB Entry: 1hwm (more details), 2.8 Å

PDB Description: ebulin,orthorhombic crystal form model
PDB Compounds: (B:) ebulin

SCOPe Domain Sequences for d1hwmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwmb1 b.42.2.1 (B:3-135) Plant cytotoxin B-chain (lectin) {Sambucus ebulus, ebulin [TaxId: 28503]}
etcaipapftrrivgrdglcvdvrngydtdgtpiqlwpcgtqrnqqwtfyndktirsmgk
cmtanglnsgsyimitdcstaaedatkwevlidgsiinpssglvmtapsgasrttlllen
nihaasqgwtvsn

SCOPe Domain Coordinates for d1hwmb1:

Click to download the PDB-style file with coordinates for d1hwmb1.
(The format of our PDB-style files is described here.)

Timeline for d1hwmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hwmb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1hwma_