Lineage for d2miba_ (2mib A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2401196Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2401197Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2401515Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins)
  6. 2401543Protein Interleukin-1beta [50363] (2 species)
  7. 2401599Species Mouse (Mus musculus) [TaxId:10090] [50365] (2 PDB entries)
  8. 2401601Domain d2miba_: 2mib A: [25551]

Details for d2miba_

PDB Entry: 2mib (more details), 2.84 Å

PDB Description: the structure of murine interleukin-1 beta at 2.8 angstroms resolution
PDB Compounds: (A:) interleukin-1 beta

SCOPe Domain Sequences for d2miba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2miba_ b.42.1.2 (A:) Interleukin-1beta {Mouse (Mus musculus) [TaxId: 10090]}
irqlhyrlrdeqqkslvlsdpyelkalhlngqninqqvifsmsfvqgepsndkipvalgl
kgknlylscvmkdgtptlqlesvdpkqypkkkmekrfvfnkievkskvefesaefpnwyi
stsqaehkpvflgnnsgqdiidftmesvs

SCOPe Domain Coordinates for d2miba_:

Click to download the PDB-style file with coordinates for d2miba_.
(The format of our PDB-style files is described here.)

Timeline for d2miba_: