Class b: All beta proteins [48724] (178 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.2: Interleukin-1 (IL-1) [50362] (6 proteins) |
Protein Interleukin-1beta [50363] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50365] (2 PDB entries) |
Domain d2miba_: 2mib A: [25551] |
PDB Entry: 2mib (more details), 2.84 Å
SCOPe Domain Sequences for d2miba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2miba_ b.42.1.2 (A:) Interleukin-1beta {Mouse (Mus musculus) [TaxId: 10090]} irqlhyrlrdeqqkslvlsdpyelkalhlngqninqqvifsmsfvqgepsndkipvalgl kgknlylscvmkdgtptlqlesvdpkqypkkkmekrfvfnkievkskvefesaefpnwyi stsqaehkpvflgnnsgqdiidftmesvs
Timeline for d2miba_: