SCOPe 2.08: Domain d2axma_: 2axm A:

Lineage for d2axma_ (2axm A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d2axma_: 2axm A: [25519]
   Heparin-linked biologically-active dimer

Details for d2axma_

PDB Entry: 2axm, 3 Å

PDB Description: heparin-linked biologically-active dimer of fibroblast growth factor

PDB Compounds: (A:) acidic fibroblast growth factor

SCOPe Domain Sequences for d2axma_:

Sequence; same for both SEQRES and ATOM records:

>d2axma_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
kkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamd
tdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqk
ailflplpvs

Timeline for d2axma_:

• d2axma_ first appeared (with stable ids) in SCOP 1.55
  
• d2axma_ appears in SCOPe 2.07