Class b: All beta proteins [48724] (174 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (2 families) |
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (9 proteins) |
Protein Basic FGF (FGF2) [50355] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50356] (16 PDB entries) |
Domain d1fq9b_: 1fq9 B: [25501] Other proteins in same PDB: d1fq9c1, d1fq9c2, d1fq9d1, d1fq9d2 complexed with idu, sgn, uap; mutant |
PDB Entry: 1fq9 (more details), 3 Å
SCOP Domain Sequences for d1fq9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fq9b_ b.42.1.1 (B:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]} hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk ailflpmsa
Timeline for d1fq9b_: