SCOP 1.75: Domain d1fq9b_: 1fq9 B:

Lineage for d1fq9b_ (1fq9 B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (2 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (9 proteins)

6. Protein Basic FGF (FGF2) [50355] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50356] (16 PDB entries)

8. Domain d1fq9b_: 1fq9 B: [25501]
   Other proteins in same PDB: d1fq9c1, d1fq9c2, d1fq9d1, d1fq9d2
   complexed with idu, sgn, uap; mutant

Details for d1fq9b_

PDB Entry: 1fq9, 3 Å

PDB Description: crystal structure of a ternary fgf2-fgfr1-heparin complex

PDB Compounds: (B:) fibroblast growth factor 2

SCOP Domain Sequences for d1fq9b_:

Sequence; same for both SEQRES and ATOM records:

>d1fq9b_ b.42.1.1 (B:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]}
hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
ailflpmsa

Timeline for d1fq9b_:

• d1fq9b_ first appeared (with stable ids) in SCOP 1.55
  
• d1fq9b_ appears in SCOP 1.73
  
• d1fq9b_ appears in SCOPe 2.01
  
• d1fq9b_ appears in the current release, SCOPe 2.08