Lineage for d1fq9b_ (1fq9 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2384843Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2384844Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 protein domains)
  6. 2385080Protein Basic FGF (FGF2) [50355] (1 species)
  7. 2385081Species Human (Homo sapiens) [TaxId:9606] [50356] (20 PDB entries)
  8. 2385109Domain d1fq9b_: 1fq9 B: [25501]
    Other proteins in same PDB: d1fq9c1, d1fq9c2, d1fq9d1, d1fq9d2

Details for d1fq9b_

PDB Entry: 1fq9 (more details), 3 Å

PDB Description: crystal structure of a ternary fgf2-fgfr1-heparin complex
PDB Compounds: (B:) fibroblast growth factor 2

SCOPe Domain Sequences for d1fq9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fq9b_ b.42.1.1 (B:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]}
hfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanryla
mkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqk
ailflpmsa

SCOPe Domain Coordinates for d1fq9b_:

Click to download the PDB-style file with coordinates for d1fq9b_.
(The format of our PDB-style files is described here.)

Timeline for d1fq9b_: