![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
![]() | Superfamily b.41.1: PRC-barrel domain [50346] (4 families) ![]() |
![]() | Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein) |
![]() | Protein Photosynthetic reaction centre [50348] (3 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [50350] (39 PDB entries) Uniprot P11846 |
![]() | Domain d1e6dh1: 1e6d H:36-250 [25465] Other proteins in same PDB: d1e6dh2, d1e6dl_, d1e6dm_ complexed with bcl, bph, fe, lda, po4, spn, u10; mutant |
PDB Entry: 1e6d (more details), 2.3 Å
SCOPe Domain Sequences for d1e6dh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6dh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]} mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag iptiksptevtlleedkicgyvagglmyaapkrks
Timeline for d1e6dh1: