Lineage for d3prch1 (3prc H:37-258)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126036Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 1126037Superfamily b.41.1: PRC-barrel domain [50346] (4 families) (S)
  5. 1126038Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)
  6. 1126039Protein Photosynthetic reaction centre [50348] (3 species)
  7. 1126088Species Rhodopseudomonas viridis [TaxId:1079] [50349] (11 PDB entries)
  8. 1126095Domain d3prch1: 3prc H:37-258 [25458]
    Other proteins in same PDB: d3prcc_, d3prch2, d3prcl_, d3prcm_
    complexed with bcb, bpb, fe2, hem, lda, mq7, ns5, so4

Details for d3prch1

PDB Entry: 3prc (more details), 2.4 Å

PDB Description: photosynthetic reaction center from rhodopseudomonas viridis (qb-depleted)
PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d3prch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3prch1 b.41.1.1 (H:37-258) Photosynthetic reaction centre {Rhodopseudomonas viridis [TaxId: 1079]}
rregyplveplglvklapedgqvyelpypktfvlphggtvtvprrrpetrelklaqtdgf
egaplqptgnplvdavgpasyaeraevvdatvdgkakivplrvatdfsiaegdvdprglp
vvaadgveagtvtdlwvdrsehyfrylelsvagsartaliplgfcdvkkdkivvtsilse
qfanvprlqsrdqitlreedkvsayyaggllyatperaesll

SCOPe Domain Coordinates for d3prch1:

Click to download the PDB-style file with coordinates for d3prch1.
(The format of our PDB-style files is described here.)

Timeline for d3prch1: