SCOPe 2.07: Domain d4obba_: 4obb A:

Lineage for d4obba_ (4obb A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (76 species)
   not a true protein

7. Species Anabaena variabilis [TaxId:240292] [256373] (9 PDB entries)

8. Domain d4obba_: 4obb A: [254047]
   automated match to d3ipca_
   complexed with 1qq, mg

Details for d4obba_

PDB Entry: 4obb, 1.53 Å

PDB Description: The crystal structure of a solute-binding protein from Anabaena variabilis ATCC 29413 in complex with (3S)-3-methyl-2-oxopentanoic acid.

PDB Compounds: (A:) Amino acid/amide ABC transporter substrate-binding protein, HAAT family

SCOPe Domain Sequences for d4obba_:

Sequence; same for both SEQRES and ATOM records:

>d4obba_ c.93.1.0 (A:) automated matches {Anabaena variabilis [TaxId: 240292]}
ntipigialaqtsnvallgqeqvagakiaekyfndkggvngtpiklifqdtagdeagtin
afqtlinkdkvvgivgptlsqqafsanpiaerakvpvvgpsntakgipeigdyvarvsap
vsvvapnsvkaalkqnpnikkvavffaqndafskseteifqqtvkdqglelvtvqkfqtt
dtdfqsqatnainlkpdlviisglaadggnlvrqlrelgyqgaiiggnglntsnvfavck
alcdgvliaqayspeytgeinkafrqayvdqykkeppqfsaqafaavqvyveslkaldtk
nkvskiqlpelrtelnkqlltgkyntplgeisftpigevvqkdfyvaqikmekdgsqgkf
tflk

Timeline for d4obba_:

• d4obba_ first appeared in SCOPe 2.04
  
• d4obba_ appears in SCOPe 2.06
  
• d4obba_ appears in the current release, SCOPe 2.08