Lineage for d4noga_ (4nog A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132988Species Toxoplasma gondii [TaxId:508771] [256372] (8 PDB entries)
  8. 2132989Domain d4noga_: 4nog A: [254010]
    automated match to d2byja1
    complexed with act, bme, btb, peg, plp

Details for d4noga_

PDB Entry: 4nog (more details), 1.2 Å

PDB Description: crystal structure of a putative ornithine aminotransferase from toxoplasma gondii me49 in complex with pyrodoxal-5'-phosphate
PDB Compounds: (A:) Putative ornithine aminotransferase, mitochondrial

SCOPe Domain Sequences for d4noga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4noga_ c.67.1.0 (A:) automated matches {Toxoplasma gondii [TaxId: 508771]}
rktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydfla
gvsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntga
eagesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftpg
felidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvllivd
eiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgstf
ggnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllnav
evdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflavee
er

SCOPe Domain Coordinates for d4noga_:

Click to download the PDB-style file with coordinates for d4noga_.
(The format of our PDB-style files is described here.)

Timeline for d4noga_: