Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
Protein automated matches [190151] (166 species) not a true protein |
Species Toxoplasma gondii [TaxId:508771] [256372] (8 PDB entries) |
Domain d4noga_: 4nog A: [254010] automated match to d2byja1 complexed with act, bme, btb, peg, plp |
PDB Entry: 4nog (more details), 1.2 Å
SCOPe Domain Sequences for d4noga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4noga_ c.67.1.0 (A:) automated matches {Toxoplasma gondii [TaxId: 508771]} rktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydfla gvsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntga eagesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftpg felidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvllivd eiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgstf ggnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllnav evdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflavee er
Timeline for d4noga_: