PDB entry 4nog

View 4nog on RCSB PDB site
Description: Crystal structure of a putative ornithine aminotransferase from Toxoplasma gondii ME49 in complex with pyrodoxal-5'-phosphate
Class: transferase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases, CSGID, ornithine aminotransferase, Toxoplasma, Transferase
Deposited on 2013-11-19, released 2013-12-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative ornithine aminotransferase, mitochondrial
    Species: TOXOPLASMA GONDII [TaxId:508771]
    Gene: TGME49_069110, TGME49_269110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4noga_
  • Chain 'B':
    Compound: Putative ornithine aminotransferase, mitochondrial
    Species: TOXOPLASMA GONDII [TaxId:508771]
    Gene: TGME49_069110, TGME49_269110
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nogb_
  • Heterogens: PLP, BME, ACT, BTB, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nogA (A:)
    marktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydf
    lagvsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmnt
    gaeagesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpft
    pgfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvlli
    vdeiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgs
    tfggnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrglln
    avevdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflav
    eeerkkgenlyfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nogA (A:)
    rktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydfla
    gvsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntga
    eagesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftpg
    felidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvllivd
    eiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgstf
    ggnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllnav
    evdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflavee
    er
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nogB (B:)
    marktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydf
    lagvsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmnt
    gaeagesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpft
    pgfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvlli
    vdeiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgs
    tfggnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrglln
    avevdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflav
    eeerkkgenlyfqsaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nogB (B:)
    arktnieayrdglklkteedffacdrqyvcqnyapvpvviskgkgarvwdingneyydfl
    agvsslsqghchprviaalcrqaerltltlrafgndvtgpacrfmaemfgydrvllmntg
    aeagesalkiarkwayevkeippdsakvilcnnnywgrtitacsssttfdcynnfgpftp
    gfelidyddvgaleealkdpnvaaffvepiqgeggvnvpkpgylkrahelcrsknvlliv
    deiqtglcrtgrllaadhdevhpdilllgkslsagvvpisavmgradvmdvlkpgthgst
    fggnplacavavealtvlkdekladraerlgaqfrdclrrelygkvpwikeirgrgllna
    vevdsdaidpndvvmklkengilskptrgrvmrfipplvitdeehrdattriiksflave
    eerk