Lineage for d4njxc_ (4njx C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1636414Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 1636415Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 1636416Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 1636481Protein automated matches [191082] (2 species)
    not a true protein
  7. 1636487Species Human (Homo sapiens) [TaxId:9606] [189791] (7 PDB entries)
  8. 1636503Domain d4njxc_: 4njx C: [253961]
    automated match to d3tw2a_

Details for d4njxc_

PDB Entry: 4njx (more details), 2.83 Å

PDB Description: human histidine triad nucleotide-binding protein 2 (hhint2) in p41212 space group at 2.83 a
PDB Compounds: (C:) Histidine triad nucleotide-binding protein 2, mitochondrial

SCOPe Domain Sequences for d4njxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4njxc_ d.13.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slpadilyedqqclvfrdvapqapvhflvipkkpiprisqaeeedqqllghlllvakqta
kaeglgdgyrlvindgklgaqsvyhlhihvlggrqlqwppg

SCOPe Domain Coordinates for d4njxc_:

Click to download the PDB-style file with coordinates for d4njxc_.
(The format of our PDB-style files is described here.)

Timeline for d4njxc_: