Lineage for d4nahb_ (4nah B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2119569Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2119570Protein automated matches [190459] (50 species)
    not a true protein
  7. 2119830Species Staphylococcus aureus [TaxId:196620] [237670] (3 PDB entries)
  8. 2119835Domain d4nahb_: 4nah B: [253926]
    automated match to d4naua_
    complexed with 2vj, ags

Details for d4nahb_

PDB Entry: 4nah (more details), 2.38 Å

PDB Description: Inhibitors of 4-Phosphopanthetheine Adenylyltransferase (PPAT)
PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d4nahb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nahb_ c.26.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 196620]}
mehtiavipgsfdpityghldiierstdrfdeihvcvlknskkegtfsleermdlieqsv
khlpnvkvhqfsgllvdyceqvgaktiirglravsdfeyelrltsmnkklnneietlymm
sstnysfisssivkevaayradisefvppyvekalkkkfk

SCOPe Domain Coordinates for d4nahb_:

Click to download the PDB-style file with coordinates for d4nahb_.
(The format of our PDB-style files is described here.)

Timeline for d4nahb_: