Lineage for d4n83f_ (4n83 F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317148Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2317149Protein automated matches [190036] (58 species)
    not a true protein
  7. 2318375Species Streptococcus sanguinis [TaxId:388919] [256369] (1 PDB entry)
  8. 2318381Domain d4n83f_: 4n83 F: [253922]
    automated match to d2r2fa_
    complexed with mn

Details for d4n83f_

PDB Entry: 4n83 (more details), 2.65 Å

PDB Description: x-ray crystal structure of streptococcus sanguinis dimanganese(ii)- nrdf
PDB Compounds: (F:) Ribonucleoside-diphosphate reductase subunit beta

SCOPe Domain Sequences for d4n83f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n83f_ a.25.1.0 (F:) automated matches {Streptococcus sanguinis [TaxId: 388919]}
tyykainwnaiedvidkstweklteqfwldtriplsndlddwrklshkekdlvgkvfggl
tlldtlqsesgvdalrkdvrtaheeavfnniqfmesvhaksyssifstlntkseideifa
wtntnpylqkkaeiineiylngtalekkiasvfletflfysgfftplyylgnnklanvae
iikliirdesvhgtyigykfqlafnelpedeqeklkewmydllytlyeneegyteslydt
vgwteevktflrynankalmnlgqdplfpdsaddvnpivmngis

SCOPe Domain Coordinates for d4n83f_:

Click to download the PDB-style file with coordinates for d4n83f_.
(The format of our PDB-style files is described here.)

Timeline for d4n83f_: