Lineage for d4mpca2 (4mpc A:182-394)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1924588Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1924589Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1925082Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins)
  6. 1925101Protein automated matches [230554] (2 species)
    not a true protein
  7. 1925102Species Human (Homo sapiens) [TaxId:9606] [230555] (13 PDB entries)
  8. 1925103Domain d4mpca2: 4mpc A:182-394 [253822]
    Other proteins in same PDB: d4mpca1
    automated match to d2bu8a2
    complexed with pv2, tla

Details for d4mpca2

PDB Entry: 4mpc (more details), 1.7 Å

PDB Description: Crystal structure of pyruvate dehydrogenase kinase isoform 2 in complex with inhibitor PS2
PDB Compounds: (A:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d4mpca2:

Sequence, based on SEQRES records: (download)

>d4mpca2 d.122.1.4 (A:182-394) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pahpkhigsidpncnvsevvkdaydmakllcdkyymaspdleiqeinaanskqpihmvyv
pshlyhmlfelfknamratveshesslilppikvmvalgeedlsikmsdrgggvplrkie
rlfsymystaptpqpgtggtplagfgyglpisrlyakyfqgdlqlfsmegfgtdaviylk
alstdsverlpvynksawrhyqtiqeagdwcvp

Sequence, based on observed residues (ATOM records): (download)

>d4mpca2 d.122.1.4 (A:182-394) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pahpkhigsidpncnvsevvkdaydmakllcdkyymaspdleiqeinaanskqpihmvyv
pshlyhmlfelfknamratveshesslilppikvmvalgeedlsikmsdrgggvplrkie
rlfsymystgyglpisrlyakyfqgdlqlfsmegfgtdaviylkalstdsverlpvynks
awrhyqtiqeagdwcvp

SCOPe Domain Coordinates for d4mpca2:

Click to download the PDB-style file with coordinates for d4mpca2.
(The format of our PDB-style files is described here.)

Timeline for d4mpca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4mpca1