SCOPe 2.05: Domain d4mpca1: 4mpc A:12-177

Lineage for d4mpca1 (4mpc A:12-177)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families)
   automatically mapped to Pfam PF10436

5. Family a.29.5.1: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69013] (3 proteins)

6. Protein automated matches [230549] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [230552] (13 PDB entries)

8. Domain d4mpca1: 4mpc A:12-177 [253821]
   Other proteins in same PDB: d4mpca2
   automated match to d2bu8a1
   complexed with pv2, tla

Details for d4mpca1

PDB Entry: 4mpc, 1.7 Å

PDB Description: Crystal structure of pyruvate dehydrogenase kinase isoform 2 in complex with inhibitor PS2

PDB Compounds: (A:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial

SCOPe Domain Sequences for d4mpca1:

Sequence; same for both SEQRES and ATOM records:

>d4mpca1 a.29.5.1 (A:12-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slagapkyiehfskfspsplsmkqfldfgssnacektsftflrqelpvrlanimkeinll
pdrvlstpsvqlvqswyvqslldimefldkdpedhrtlsqftdalvtirnrhndvvptma
qgvleykdtygddpvsnqniqyfldrfylsrisirmlinqhtlifd

Timeline for d4mpca1:

• d4mpca1 first appeared in SCOPe 2.04
  
• d4mpca1 appears in SCOPe 2.06
  
• d4mpca1 appears in the current release, SCOPe 2.08