| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
| Protein automated matches [190205] (26 species) not a true protein |
| Species Bartonella tribocorum [TaxId:382640] [256364] (1 PDB entry) |
| Domain d4meia_: 4mei A: [253796] automated match to d2bhma1 |
PDB Entry: 4mei (more details), 2.85 Å
SCOPe Domain Sequences for d4meia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4meia_ d.17.4.0 (A:) automated matches {Bartonella tribocorum [TaxId: 382640]}
ydeaitryfasqyvraregfqaseaensfrlvsllsspkeqnrfakwyagnnpespqniy
hnmiatvtiksisfiskdliqvryyktvrdfseketishwvsilnfsyvnahistsdrli
nplgfqvseyrsdpev
Timeline for d4meia_: