Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.5: Ephrin ectodomain [74874] (3 proteins) eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site automatically mapped to Pfam PF00812 |
Protein automated matches [190316] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187131] (6 PDB entries) |
Domain d4m4rd1: 4m4r D:27-165 [253743] Other proteins in same PDB: d4m4rb2, d4m4rd2 automated match to d1shxa_ complexed with nag |
PDB Entry: 4m4r (more details), 3.13 Å
SCOPe Domain Sequences for d4m4rd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m4rd1 b.6.1.5 (D:27-165) automated matches {Human (Homo sapiens) [TaxId: 9606]} avadryavywnssnprfqrgdyhidvcindyldvfcphyedsvpedkteryvlymvnfdg ysacdhtskgfkrwecnrphspngplkfsekfqlftpfslgfefrpgreyfyissaipdn grrsclklkvfvrptnscm
Timeline for d4m4rd1:
View in 3D Domains from other chains: (mouse over for more information) d4m4rb1, d4m4rb2, d4m4rf_, d4m4rh_ |