| Class b: All beta proteins [48724] (176 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
| Family b.42.2.0: automated matches [227190] (1 protein) not a true family |
| Protein automated matches [226913] (8 species) not a true protein |
| Species Clostridium botulinum [TaxId:1491] [254975] (6 PDB entries) |
| Domain d4lo1a2: 4lo1 A:152-294 [253661] automated match to d2e4ma2 complexed with gal |
PDB Entry: 4lo1 (more details), 2.25 Å
SCOPe Domain Sequences for d4lo1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lo1a2 b.42.2.0 (A:152-294) automated matches {Clostridium botulinum [TaxId: 1491]}
nftckispildlnkvvqqvdvtnlnvnlytwdygrnqkwtiryneekaayqffntilsng
vltwifsngntvrvsssndqnndaqywlinpvsdtdetytitnlrdttkaldlyggqtan
gtaiqvfnyhgddnqkwnirnpp
Timeline for d4lo1a2: