SCOPe 2.07: Domain d4lmfc2: 4lmf C:117-159

Lineage for d4lmfc2 (4lmf C:117-159)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Complement C1S component [90143] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90144] (3 PDB entries)

8. Domain d4lmfc2: 4lmf C:117-159 [253625]
   Other proteins in same PDB: d4lmfa1, d4lmfa3, d4lmfb1, d4lmfb3, d4lmfc1, d4lmfc3, d4lmfd1, d4lmfd3
   automated match to d1nt0a3
   complexed with ca, na

Details for d4lmfc2

PDB Entry: 4lmf, 2.92 Å

PDB Description: c1s cub1-egf-cub2

PDB Compounds: (C:) Complement C1s subcomponent heavy chain

SCOPe Domain Sequences for d4lmfc2:

Sequence; same for both SEQRES and ATOM records:

>d4lmfc2 g.3.11.1 (C:117-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}
inectdfvdvpcshfcnnfiggyfcscppeyflhddmkncgvn

Timeline for d4lmfc2:

• d4lmfc2 first appeared in SCOPe 2.04
  
• d4lmfc2 appears in SCOPe 2.06
  
• d4lmfc2 appears in the current release, SCOPe 2.08