Lineage for d4lktc1 (4lkt C:1-135)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2413759Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2413760Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2414378Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2414571Protein Epidermal fatty acid binding protein [50854] (1 species)
  7. 2414572Species Human (Homo sapiens) [TaxId:9606] [50855] (6 PDB entries)
  8. 2414586Domain d4lktc1: 4lkt C:1-135 [253616]
    Other proteins in same PDB: d4lkta2, d4lktb2, d4lktc2, d4lktd2
    automated match to d4lkpa_
    complexed with cit, cl, eic, gol, nh4, so4, tar

Details for d4lktc1

PDB Entry: 4lkt (more details), 2.57 Å

PDB Description: crystal structure of human epidermal fatty acid binding protein (fabp5) in complex with linoleic acid
PDB Compounds: (C:) fatty acid-binding protein, epidermal

SCOPe Domain Sequences for d4lktc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lktc1 b.60.1.2 (C:1-135) Epidermal fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]}
matvqqlegrwrlvdskgfdeymkelgvgialrkmgamakpdciitcdgknltiktestl
kttqfsctlgekfeettadgrktqtvcnftdgalvqhqewdgkestitrklkdgklvvec
vmnnvtctriyekve

SCOPe Domain Coordinates for d4lktc1:

Click to download the PDB-style file with coordinates for d4lktc1.
(The format of our PDB-style files is described here.)

Timeline for d4lktc1: