Class b: All beta proteins [48724] (178 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Epidermal fatty acid binding protein [50854] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50855] (6 PDB entries) |
Domain d4lktc1: 4lkt C:1-135 [253616] Other proteins in same PDB: d4lkta2, d4lktb2, d4lktc2, d4lktd2 automated match to d4lkpa_ complexed with cit, cl, eic, gol, nh4, so4, tar |
PDB Entry: 4lkt (more details), 2.57 Å
SCOPe Domain Sequences for d4lktc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lktc1 b.60.1.2 (C:1-135) Epidermal fatty acid binding protein {Human (Homo sapiens) [TaxId: 9606]} matvqqlegrwrlvdskgfdeymkelgvgialrkmgamakpdciitcdgknltiktestl kttqfsctlgekfeettadgrktqtvcnftdgalvqhqewdgkestitrklkdgklvvec vmnnvtctriyekve
Timeline for d4lktc1: