SCOPe 2.08: Domain d4lkhb_: 4lkh B:

Lineage for d4lkhb_ (4lkh B:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (29 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [255822] (26 PDB entries)

8. Domain d4lkhb_: 4lkh B: [253613]
   Other proteins in same PDB: d4lkha_
   automated match to d2viub_
   complexed with nag, sia

Details for d4lkhb_

PDB Entry: 4lkh, 3.1 Å

PDB Description: the structure of hemagglutinin from a avian-origin h7n9 influenza virus (a/shanghai/1/2013) in complex with human receptor analog 6'slnln

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4lkhb_:

Sequence; same for both SEQRES and ATOM records:

>d4lkhb_ h.3.1.1 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr

Timeline for d4lkhb_:

• d4lkhb_ first appeared in SCOPe 2.04
  
• d4lkhb_ appears in SCOPe 2.07