Lineage for d4lkhb_ (4lkh B:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2646215Species Influenza A virus, different strains [TaxId:11320] [255822] (42 PDB entries)
  8. 2646327Domain d4lkhb_: 4lkh B: [253613]
    Other proteins in same PDB: d4lkha_
    automated match to d2viub_
    complexed with nag, sia

Details for d4lkhb_

PDB Entry: 4lkh (more details), 3.1 Å

PDB Description: the structure of hemagglutinin from a avian-origin h7n9 influenza virus (a/shanghai/1/2013) in complex with human receptor analog 6'slnln
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4lkhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lkhb_ h.3.1.1 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr

SCOPe Domain Coordinates for d4lkhb_:

Click to download the PDB-style file with coordinates for d4lkhb_.
(The format of our PDB-style files is described here.)

Timeline for d4lkhb_: