SCOPe 2.04: Domain d4lcxf_: 4lcx F:

Lineage for d4lcxf_ (4lcx F:)

1. Root: SCOPe 2.04

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (7 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (95 PDB entries)

8. Domain d4lcxf_: 4lcx F: [253553]
   Other proteins in same PDB: d4lcxa_, d4lcxc_, d4lcxe_
   automated match to d2viub_
   complexed with nag

Details for d4lcxf_

PDB Entry: 4lcx, 3.09 Å

PDB Description: the structure of hemagglutinin from avian-origin h7n9 influenza virus (a/shanghai/1/2013)

PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d4lcxf_:

Sequence; same for both SEQRES and ATOM records:

>d4lcxf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr

Timeline for d4lcxf_:

• d4lcxf_ is new in SCOPe 2.04-stable
  
• d4lcxf_ appears in SCOPe 2.05
  
• d4lcxf_ appears in the current release, SCOPe 2.08