Lineage for d1ah9__ (1ah9 -)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296800Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 297373Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families) (S)
  5. 297600Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins)
    barrel, closed; n=5, S=8
  6. 297734Protein Translational initiation factor 1, IF1 [50290] (1 species)
  7. 297735Species Escherichia coli [TaxId:562] [50291] (2 PDB entries)
  8. 297737Domain d1ah9__: 1ah9 - [25330]

Details for d1ah9__

PDB Entry: 1ah9 (more details)

PDB Description: the structure of the translational initiation factor if1 from escherichia coli, nmr, 19 structures

SCOP Domain Sequences for d1ah9__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ah9__ b.40.4.5 (-) Translational initiation factor 1, IF1 {Escherichia coli}
akedniemqgtvletlpntmfrvelenghvvtahisgkmrknyiriltgdkvtveltpyd
lskgrivfrsr

SCOP Domain Coordinates for d1ah9__:

Click to download the PDB-style file with coordinates for d1ah9__.
(The format of our PDB-style files is described here.)

Timeline for d1ah9__: