PDB entry 1ah9

View 1ah9 on RCSB PDB site
Description: the structure of the translational initiation factor if1 from escherichia coli, nmr, 19 structures
Deposited on 1997-04-16, released 1997-07-07
The last revision prior to the SCOP 1.65 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: NMR19
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1ah9__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ah9_ (-)
    akedniemqgtvletlpntmfrvelenghvvtahisgkmrknyiriltgdkvtveltpyd
    lskgrivfrsr