SCOP 1.65: Domain d1e3pa2: 1e3p A:656-717

Lineage for d1e3pa2 (1e3p A:656-717)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.40: OB-fold [50198] (9 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (11 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins)
   barrel, closed; n=5, S=8

6. Protein S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase [50287] (2 species)

7. Species Streptomyces antibioticus [TaxId:1890] [50289] (1 PDB entry)

8. Domain d1e3pa2: 1e3p A:656-717 [25328]
   Other proteins in same PDB: d1e3pa1, d1e3pa3, d1e3pa4, d1e3pa5, d1e3pa6, d1e3pa7
   partly disordered
   complexed with so4, wo4

Details for d1e3pa2

PDB Entry: 1e3p, 2.5 Å

PDB Description: tungstate derivative of streptomyces antibioticus pnpase/gpsi enzyme

SCOP Domain Sequences for d1e3pa2:

Sequence, based on SEQRES records:

>d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus}
gsvvktttfgafvsllpgkdgllhisqirklaggkrvenvedvlgvgqkvqveiaeidsr
gk

Sequence, based on observed residues (ATOM records):

>d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus}
gsvvkttfgafvslldgllhlgvgqkvqveiaeidsrgk

Timeline for d1e3pa2:

• d1e3pa2 first appeared (with stable ids) in SCOP 1.55
  
• d1e3pa2 appears in SCOP 1.63
  
• d1e3pa2 appears in SCOP 1.67
  
• d1e3pa2 appears in the current release, SCOPe 2.08