Class a: All alpha proteins [46456] (179 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.9: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46915] (1 family) |
Family a.4.9.1: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46916] (1 protein) |
Protein Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 [46917] (1 species) links two duplicated two-domain units formed by domains 1-2 and 4-5 |
Species Streptomyces antibioticus [TaxId:1890] [46918] (2 PDB entries) |
Domain d1e3pa1: 1e3p A:263-345 [16258] Other proteins in same PDB: d1e3pa2, d1e3pa3, d1e3pa4, d1e3pa5, d1e3pa6, d1e3pa7 complexed with so4, wo4 |
PDB Entry: 1e3p (more details), 2.5 Å
SCOP Domain Sequences for d1e3pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e3pa1 a.4.9.1 (A:263-345) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 {Streptomyces antibioticus} yqddvlealsaavrpelsaaltiagkqdreaeldrvkalaaekllpefegrekeisaayr altkslvrerviaekkridgrgv
Timeline for d1e3pa1: