Lineage for d4kjwd2 (4kjw D:107-211)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1763627Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)
  8. 1764201Domain d4kjwd2: 4kjw D:107-211 [253271]
    Other proteins in same PDB: d4kjwa_, d4kjwb_, d4kjwd1, d4kjwf1
    automated match to d1ikfl2

Details for d4kjwd2

PDB Entry: 4kjw (more details), 3.03 Å

PDB Description: Structure of the CLC-ec1 deltaNC construct in 100mM fluoride and 20mM bromide
PDB Compounds: (D:) Fab, light chain

SCOPe Domain Sequences for d4kjwd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kjwd2 b.1.1.2 (D:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOPe Domain Coordinates for d4kjwd2:

Click to download the PDB-style file with coordinates for d4kjwd2.
(The format of our PDB-style files is described here.)

Timeline for d4kjwd2: