|  | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) | 
|  | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 | 
|  | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)  there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules | 
|  | Domain d4k9nb1: 4k9n B:2-181 [253187] Other proteins in same PDB: d4k9na2, d4k9nb2, d4k9nc2, d4k9nd2 automated match to d2fwna2 complexed with gol, mg, tzd; mutant | 
PDB Entry: 4k9n (more details), 1.7 Å
SCOPe Domain Sequences for d4k9nb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k9nb1 c.36.1.0 (B:2-181) automated matches {Pseudomonas putida [TaxId: 303]}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
Timeline for d4k9nb1: