SCOPe 2.02: Domain d1euja_: 1euj A:

Lineage for d1euja_ (1euj A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.4: Myf domain [50277] (7 proteins)

6. Protein EMAP II [50280] (1 species)
   domain of the p43 protein

7. Species Human (Homo sapiens) [TaxId:9606] [50281] (3 PDB entries)

8. Domain d1euja_: 1euj A: [25316]

Details for d1euja_

PDB Entry: 1euj, 1.8 Å

PDB Description: a novel anti-tumor cytokine contains a rna-binding motif present in aminoacyl-trna synthetases

PDB Compounds: (A:) endothelial monocyte activating polypeptide 2

SCOPe Domain Sequences for d1euja_:

Sequence; same for both SEQRES and ATOM records:

>d1euja_ b.40.4.4 (A:) EMAP II {Human (Homo sapiens) [TaxId: 9606]}
pidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvi
llcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkk
kiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgik

Timeline for d1euja_:

• d1euja_ first appeared (with stable ids) in SCOP 1.55
  
• d1euja_ appears in SCOPe 2.01
  
• d1euja_ appears in SCOPe 2.03
  
• d1euja_ appears in the current release, SCOPe 2.08