Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein automated matches [190035] (28 species) not a true protein |
Species Canavalia boliviana [TaxId:232300] [238384] (3 PDB entries) |
Domain d4k1ya_: 4k1y A: [253136] automated match to d4k1za_ complexed with ca, cd, mn |
PDB Entry: 4k1y (more details), 2.5 Å
SCOPe Domain Sequences for d4k1ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k1ya_ b.29.1.1 (A:) automated matches {Canavalia boliviana [TaxId: 232300]} adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr lsavvsypngdsatvsydvdldnvlpewvrvglsattglyketntilswsftsklksnst hetnalhfmfnqfskdqkdlilqgdattgrdgnleltrvssngspqgssvgralfyapvh iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan
Timeline for d4k1ya_: