Lineage for d4k1yd_ (4k1y D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2778941Species Canavalia boliviana [TaxId:232300] [238384] (3 PDB entries)
  8. 2778950Domain d4k1yd_: 4k1y D: [253139]
    automated match to d4k1za_
    complexed with ca, cd, mn

Details for d4k1yd_

PDB Entry: 4k1y (more details), 2.5 Å

PDB Description: crystal structure of canavalia boliviana lectin in complex with man1- 3man-ome
PDB Compounds: (D:) Canavalia boliviana lectin

SCOPe Domain Sequences for d4k1yd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k1yd_ b.29.1.1 (D:) automated matches {Canavalia boliviana [TaxId: 232300]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsattglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgrdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d4k1yd_:

Click to download the PDB-style file with coordinates for d4k1yd_.
(The format of our PDB-style files is described here.)

Timeline for d4k1yd_: