Lineage for d4jtve_ (4jtv E:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531228Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1531229Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1531245Species Influenza A virus, different strains [TaxId:11320] [49825] (99 PDB entries)
  8. 1531456Domain d4jtve_: 4jtv E: [253038]
    Other proteins in same PDB: d4jtvb_, d4jtvd_, d4jtvf_, d4jtvh_, d4jtvj_, d4jtvl_
    automated match to d4edaa_
    complexed with nag, sia

Details for d4jtve_

PDB Entry: 4jtv (more details), 3 Å

PDB Description: crystal structure of 2009 pandemic influenza virus hemagglutinin complexed with human receptor analogue lstc
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4jtve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jtve_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrni

SCOPe Domain Coordinates for d4jtve_:

Click to download the PDB-style file with coordinates for d4jtve_.
(The format of our PDB-style files is described here.)

Timeline for d4jtve_: