SCOPe 2.04: Domain d4jq1b_: 4jq1 B:

Lineage for d4jq1b_ (4jq1 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species)

7. Species Human (Homo sapiens), type III [TaxId:9606] [69383] (14 PDB entries)
   bile acid binding protein

8. Domain d4jq1b_: 4jq1 B: [252998]
   automated match to d4jqab_
   complexed with edo, nap, nps, po4, tla

Details for d4jq1b_

PDB Entry: 4jq1, 1.6 Å

PDB Description: akr1c2 complex with naproxen

PDB Compounds: (B:) Aldo-keto reductase family 1 member C2

SCOPe Domain Sequences for d4jq1b_:

Sequence; same for both SEQRES and ATOM records:

>d4jq1b_ c.1.7.1 (B:) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III [TaxId: 9606]}
kyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeqvgl
airskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvsvk
pgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpglk
ykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvlca
lakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnrnv
ryltldifagppnypf

Timeline for d4jq1b_:

• d4jq1b_ is new in SCOPe 2.04-stable
  
• d4jq1b_ appears in SCOPe 2.05
  
• d4jq1b_ appears in the current release, SCOPe 2.08