Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
Protein 3-alpha-hydroxysteroid dehydrogenase [51439] (2 species) |
Species Human (Homo sapiens), type III [TaxId:9606] [69383] (14 PDB entries) bile acid binding protein |
Domain d4jq1b_: 4jq1 B: [252998] automated match to d4jqab_ complexed with edo, nap, nps, po4, tla |
PDB Entry: 4jq1 (more details), 1.6 Å
SCOPe Domain Sequences for d4jq1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jq1b_ c.1.7.1 (B:) 3-alpha-hydroxysteroid dehydrogenase {Human (Homo sapiens), type III [TaxId: 9606]} kyqcvklndghfmpvlgfgtyapaevpkskaleavklaieagfhhidsahvynneeqvgl airskiadgsvkredifytsklwsnshrpelvrpalerslknlqldyvdlylihfpvsvk pgeevipkdengkilfdtvdlcatweamekckdaglaksigvsnfnhrllemilnkpglk ykpvcnqvechpyfnqrklldfckskdivlvaysalgshreepwvdpnspvlledpvlca lakkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltseemkaidglnrnv ryltldifagppnypf
Timeline for d4jq1b_: