SCOPe 2.05: Domain d4jm2c2: 4jm2 C:110-212

Lineage for d4jm2c2 (4jm2 C:110-212)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4jm2c2: 4jm2 C:110-212 [252983]
   Other proteins in same PDB: d4jm2b1, d4jm2c1, d4jm2e_, d4jm2f1, d4jm2f2
   automated match to d2nxyc2
   complexed with nag, pg4

Details for d4jm2c2

PDB Entry: 4jm2, 3.1 Å

PDB Description: crystal structure of pgt 135 fab in complex with gp120 core protein from hiv-1 strain jr-fl bound to cd4 and 17b fab

PDB Compounds: (C:) 17b Light chain

SCOPe Domain Sequences for d4jm2c2:

Sequence; same for both SEQRES and ATOM records:

>d4jm2c2 b.1.1.2 (C:110-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdsk
dstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d4jm2c2:

• d4jm2c2 first appeared in SCOPe 2.04
  
• d4jm2c2 appears in SCOPe 2.06
  
• d4jm2c2 appears in the current release, SCOPe 2.08