SCOPe 2.05: Domain d4jlzb1: 4jlz B:135-382

Lineage for d4jlzb1 (4jlz B:135-382)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
   core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123

4. Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families)

5. Family d.218.1.15: cGAMP synthase, cGAS N-terminal domain [254174] (1 protein)
   Pfam PF03281; PubMed 23647843; structurally very similar to hOAS1 (d.218.1.6)

6. Protein cGAMP synthase, cGAS N-terminal domain [254394] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [256336] (2 PDB entries)

8. Domain d4jlzb1: 4jlz B:135-382 [252978]
   Other proteins in same PDB: d4jlza2, d4jlzb2
   automated match to d4k8va1
   protein/DNA complex; complexed with mg, utp, zn

Details for d4jlzb1

PDB Entry: 4jlz, 2.27 Å

PDB Description: Structure of porcine cGAS in complex with bound UTP

PDB Compounds: (B:) Uncharacterized protein

SCOPe Domain Sequences for d4jlzb1:

Sequence, based on SEQRES records:

>d4jlzb1 d.218.1.15 (B:135-382) cGAMP synthase, cGAS N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
gawklqtvlekvrlsrheiseaaevvnwvvehllrrlqggesefkgvallrtgsyyervk
isapnefdvmfklevpriqleeycnsgahyfvkfkrnpggnpleqflekeilsaskmlsk
frkiikeeikniedtgvtverkrrgspavtlliskpkeisvdiilalesksswpastqkg
lpisqwlgakvknnlkrqpfylvpkhakegsgfqeetwrlsfshiekdilknhgqsktcc
eidgvkcc

Sequence, based on observed residues (ATOM records):

>d4jlzb1 d.218.1.15 (B:135-382) cGAMP synthase, cGAS N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
gawklqtvlekvrlsrheiseaaevvnwvvehllrrlqggesefkgvallrtgsyyervk
isapnefdvmfklevpriqleeycnsgahyfvkfpleqfleeilsaskmlskfrkiikee
ikniedtgvtverkrrgspavtlliskpkeisvdiilalesksswpastqkglpisqwlg
akvknnlkrqpfylvpkhakegsgfqeetwrlsfshiekdilknhgqsktcceidgvkcc

Timeline for d4jlzb1:

• d4jlzb1 first appeared in SCOPe 2.04
  
• d4jlzb1 appears in SCOPe 2.06
  
• d4jlzb1 appears in the current release, SCOPe 2.08