Lineage for d1fgua2 (1fgu A:299-426)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 463443Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 463510Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins)
    barrel, closed; n=5, S=10
  6. 463571Protein Replication protein A 70 KDa subunit (RPA70) [50267] (1 species)
    duplication: consists of three domains of this fold; contains zinc-finger insert in the C-terminal domain, residues 479-511
  7. 463572Species Human (Homo sapiens) [TaxId:9606] [50268] (4 PDB entries)
  8. 463574Domain d1fgua2: 1fgu A:299-426 [25297]

Details for d1fgua2

PDB Entry: 1fgu (more details), 2.5 Å

PDB Description: ssdna-binding domain of the large subunit of replication protein a

SCOP Domain Sequences for d1fgua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fgua2 b.40.4.3 (A:299-426) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens)}
qfdftgiddlenkskdslvdiigicksyedatkitvrsnnrevakrniylmdtsgkvvta
tlwgedadkfdgsrqpvlaikgarvsdfggrslsvlssstiianpdipeayklrgwfdae
gqaldgvs

SCOP Domain Coordinates for d1fgua2:

Click to download the PDB-style file with coordinates for d1fgua2.
(The format of our PDB-style files is described here.)

Timeline for d1fgua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fgua1