Class b: All beta proteins [48724] (144 folds) |
Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins) barrel, closed; n=5, S=10 |
Protein Replication protein A 70 KDa subunit (RPA70) [50267] (1 species) duplication: consists of three domains of this fold; contains zinc-finger insert in the C-terminal domain, residues 479-511 |
Species Human (Homo sapiens) [TaxId:9606] [50268] (4 PDB entries) |
Domain d1fgua2: 1fgu A:299-426 [25297] |
PDB Entry: 1fgu (more details), 2.5 Å
SCOP Domain Sequences for d1fgua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fgua2 b.40.4.3 (A:299-426) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens)} qfdftgiddlenkskdslvdiigicksyedatkitvrsnnrevakrniylmdtsgkvvta tlwgedadkfdgsrqpvlaikgarvsdfggrslsvlssstiianpdipeayklrgwfdae gqaldgvs
Timeline for d1fgua2: